| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332246.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TSAMSRRSDALSTIAGYSGYGAEQGEKNLRAAIASTYYSGLGIEEEDIFVSDGAKSDISRLQVLFGSNVTMAVQDPSYPAYVDSSVILGQTGLFQKDEEKYAKIEYMRCTPENGFFPDLA TVRKTDIIFFCSPNNPTGYAASREQLTKLVQFAKENGSIIVYDSAYAMYVSDDSPRSIFEIPGAKEVALEVSSFSKYAGFTGVRLGRTAIPKELHYSDGFPVAKDFNRIVCTCFNGASNI CSAGGLACVSPEG | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,334.322 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21235 | ||
| Instability index: | 53.858 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.277 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332246.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| TSAMSRRSDALSTIAGYSGYGAEQGEKNLRAAIASTYYSGLGIEEEDIFVSDGAKSDISRLQVLFGSNVTMAVQDPSYPAYVDSSVILGQTGLFQKDEEKYAKIEYMRCTPENGFFPDLA TVRKTDIIFFCSPNNPTGYAASREQLTKLVQFAKENGSIIVYDSAYAMYVSDDSPRSIFEIPGAKEVALEVSSFSKYAGFTGVRLGRTAIPKELHYSDGFPVAKDFNRIVCTCFNGASNI CSAGGLACVSPEG | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,334.322 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21235 | ||
| Instability index: | 53.858 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.277 | ||
| sheet | 0.233 | ||