Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332247.1	5prime_partial	140	1-423(+)
Amino Acid sequence :
DVMTEEKLHQINNFWSDSEYRLNKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRITDIDTSGIFDSDDMTIKAALAISDTKGGDGEGIGGLQRGE SDHPRCKRGHRKCIQETISK*
Physicochemical properties
Number of amino acids:		140
Molecular weight:		15,424.155
Theoretical pI:		6.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		44.185
aromaticity		0.102
GRAVY		-0.550
Secondary Structure Fraction
Helix		0.285
turn		0.255
sheet		0.248

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332247.1	complete	137	326-739(+)
Amino Acid sequence :
MEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVAFLRSRSKELKPGGSMFLMLLGRTSPDPEDQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAF IINKLQLFHGGSGSHHR*
Physicochemical properties
Number of amino acids:		137
Molecular weight:		15,424.155
Theoretical pI:		6.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		44.185
aromaticity		0.102
GRAVY		-0.550
Secondary Structure Fraction
Helix		0.285
turn		0.255
sheet		0.248