| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332252.1 | complete | 136 | 149-559(+) |
Amino Acid sequence : | |||
| MEGGGKQSGTSLASDLFGTKDASQQTTFVGNFPTIFPPPPKEPFQYLESDKKISSENPSWTSNNSVSGHEEQPQSSTGKDKLLPFHYNSSIYYGGQDDYTPSESAQKSGTTFNKDGGEDH SDSSAIRSWWQGSVYY* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,891.711 | ||
| Theoretical pI: | 4.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 61.397 | ||
| aromaticity | 0.125 | ||
| GRAVY | -1.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.390 | ||
| sheet | 0.132 | ||