| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332254.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| KSGSFAMEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGV EEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLEL | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,721.484 | ||
| Theoretical pI: | 7.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16390 | ||
| Instability index: | 33.029 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.215 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332254.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| KSGSFAMEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGV EEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLEL | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,721.484 | ||
| Theoretical pI: | 7.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16390 | ||
| Instability index: | 33.029 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.215 | ||
| sheet | 0.268 | ||