Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332265.1 | 5prime_partial | 265 | 2-799(+) |
Amino Acid sequence : | |||
LTNFPRHHHSTFFPFSHLPHKNSLSLDMVGADVEEWVKAAMADDTVVVELLVRLHHAPPPKPAALPLEWSVRQRRSKSVSVGNKKAASHRGSPTTPLSWSGATSFSGSGEESSRPIPFRV STATRSKVNVDGEKAISKRSRKKKTLAELKDEESSLLKERRELKREMAALRMNLERQRATNEKLKRMKIEFHPSPSSTSEAEEPISNQFGQQPTACDPSTSLNQPVDLCENVDAASDFKC FLPDLNIPFDEPRSRLCCEGEKYDE* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,916.054 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 104.413 | ||
aromaticity | 0.044 | ||
GRAVY | -0.831 | ||
Secondary Structure Fraction | |||
Helix | 0.175 | ||
turn | 0.298 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332265.1 | complete | 114 | 129-473(+) |
Amino Acid sequence : | |||
MTRSSSSSWCGCTTRRRRSRPPCRWSGASVRGGRSRFRLGIRKRLVTGAAPPLRCRGAVPPLSAAAGKSLAGRFRSECPPRRDLRLMLMVKRPSLRGQERRRLWQNSKTKRAHC* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,916.054 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 104.413 | ||
aromaticity | 0.044 | ||
GRAVY | -0.831 | ||
Secondary Structure Fraction | |||
Helix | 0.175 | ||
turn | 0.298 | ||
sheet | 0.211 |