| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332265.1 | 5prime_partial | 265 | 2-799(+) |
Amino Acid sequence : | |||
| LTNFPRHHHSTFFPFSHLPHKNSLSLDMVGADVEEWVKAAMADDTVVVELLVRLHHAPPPKPAALPLEWSVRQRRSKSVSVGNKKAASHRGSPTTPLSWSGATSFSGSGEESSRPIPFRV STATRSKVNVDGEKAISKRSRKKKTLAELKDEESSLLKERRELKREMAALRMNLERQRATNEKLKRMKIEFHPSPSSTSEAEEPISNQFGQQPTACDPSTSLNQPVDLCENVDAASDFKC FLPDLNIPFDEPRSRLCCEGEKYDE* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 12,916.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 104.413 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.831 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.298 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332265.1 | complete | 114 | 129-473(+) |
Amino Acid sequence : | |||
| MTRSSSSSWCGCTTRRRRSRPPCRWSGASVRGGRSRFRLGIRKRLVTGAAPPLRCRGAVPPLSAAAGKSLAGRFRSECPPRRDLRLMLMVKRPSLRGQERRRLWQNSKTKRAHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,916.054 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 104.413 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.831 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.298 | ||
| sheet | 0.211 | ||