Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332271.1 | complete | 138 | 395-811(+) |
Amino Acid sequence : | |||
MTSPLLSTSRSGSESMSSMSSSDMSRLYKPAGGMVASEIICMMVSKLCMGTSGSSNWFPSSIRSAGRFFRNHGWFLISGMLMRCAGSATKILEIRCRHSSENVFWNRILDIYDSLYCSTK IPGVFRIFKWITTDQHNK* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 12,879.287 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 54.055 | ||
aromaticity | 0.070 | ||
GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.246 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332271.1 | complete | 114 | 726-382(-) |
Amino Acid sequence : | |||
MSSILFQNTFSEECRHLISRIFVADPAQRISIPEIKNHPWFLKNLPADLMDEGNQFEEPDVPMQSLETIMQIISEATIPPAGLYSLDMSDDDMEDIDSDPDLDVDSSGEVIYAM* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,879.287 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 54.055 | ||
aromaticity | 0.070 | ||
GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.246 | ||
sheet | 0.281 |