| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332271.1 | complete | 138 | 395-811(+) |
Amino Acid sequence : | |||
| MTSPLLSTSRSGSESMSSMSSSDMSRLYKPAGGMVASEIICMMVSKLCMGTSGSSNWFPSSIRSAGRFFRNHGWFLISGMLMRCAGSATKILEIRCRHSSENVFWNRILDIYDSLYCSTK IPGVFRIFKWITTDQHNK* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 12,879.287 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 54.055 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332271.1 | complete | 114 | 726-382(-) |
Amino Acid sequence : | |||
| MSSILFQNTFSEECRHLISRIFVADPAQRISIPEIKNHPWFLKNLPADLMDEGNQFEEPDVPMQSLETIMQIISEATIPPAGLYSLDMSDDDMEDIDSDPDLDVDSSGEVIYAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,879.287 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 54.055 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||