Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332272.1 | complete | 130 | 328-720(+) |
Amino Acid sequence : | |||
MMDRVGMTLGPGMDMPIMHDSDRYDFVRDIGSGNFGIARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASXGELFERISNAGRFSEDEA RFFFXHLYLE* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,964.007 | ||
Theoretical pI: | 5.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 31.455 | ||
aromaticity | 0.094 | ||
GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.188 | ||
sheet | 0.266 |