| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332274.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
| DEAKSLSSETTEQEEFTWSSVLLPFVFPALGGLLFGYDIGATSGAVISLQSPELSGTNWFNLSAVQLGLVVSGSLYGALFGSLIVYPLADFLGRRRELIVASLLYLGGGLLTACSPGLGV LLIARFLYGLGIGMAMHGAPLYIAETCPSQIRGTLISLKELFIVLGILLGYFVGSFEINAVGGWRYMFGFSAPIAFVMGLGMLSLPPSPRWLLLRA | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 11,624.157 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 37.318 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332274.1 | complete | 101 | 339-644(+) |
Amino Acid sequence : | |||
| MFSWPWSSLDSSILIRARYWHGNAWGASLHSGDLSISDSRNFNISKGAFYSSRDIVRLLCWKFRNQCCWRVALHVWIQCPNCIRYGARYAESASISKMASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,624.157 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 37.318 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332274.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
| DEAKSLSSETTEQEEFTWSSVLLPFVFPALGGLLFGYDIGATSGAVISLQSPELSGTNWFNLSAVQLGLVVSGSLYGALFGSLIVYPLADFLGRRRELIVASLLYLGGGLLTACSPGLGV LLIARFLYGLGIGMAMHGAPLYIAETCPSQIRGTLISLKELFIVLGILLGYFVGSFEINAVGGWRYMFGFSAPIAFVMGLGMLSLPPSPRWLLLRA | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 11,624.157 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 37.318 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332274.1 | complete | 101 | 339-644(+) |
Amino Acid sequence : | |||
| MFSWPWSSLDSSILIRARYWHGNAWGASLHSGDLSISDSRNFNISKGAFYSSRDIVRLLCWKFRNQCCWRVALHVWIQCPNCIRYGARYAESASISKMASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,624.157 | ||
| Theoretical pI: | 9.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 37.318 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.198 | ||