| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332278.1 | 5prime_partial | 183 | 2-553(+) |
Amino Acid sequence : | |||
| ELLRHPAKLKKLQKEVREIVKANREITNDDISQMPYLKAVIKETLRYHPPLPLLAPRVASKDVTINGFDVLAGTVVMINAWAISRDEAIWNDAKKFQPERFLNTPIDFKGTDFKFIPFGA GRRRCPGIAYGEATAELLLANIVHKFNWKLPGEAQGGKLGINETPGIAVGRATPLYALTVKSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,329.429 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 27.136 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.213 | ||
| sheet | 0.279 | ||