Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332278.1 | 5prime_partial | 183 | 2-553(+) |
Amino Acid sequence : | |||
ELLRHPAKLKKLQKEVREIVKANREITNDDISQMPYLKAVIKETLRYHPPLPLLAPRVASKDVTINGFDVLAGTVVMINAWAISRDEAIWNDAKKFQPERFLNTPIDFKGTDFKFIPFGA GRRRCPGIAYGEATAELLLANIVHKFNWKLPGEAQGGKLGINETPGIAVGRATPLYALTVKSA* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,329.429 | ||
Theoretical pI: | 9.647 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 27.136 | ||
aromaticity | 0.082 | ||
GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.213 | ||
sheet | 0.279 |