Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332280.1 | complete | 108 | 182-508(+) |
Amino Acid sequence : | |||
MLLICGQRQRRWLSLGFGLEDLDSLPGEVRIIAAKVAVSSSFLVPEVSSPLQVQVDGDHSWPEVEVLLDKCQNILVRDLTSLVSINEHRKWLCYTNSIQHLHNGGGLD* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,061.689 | ||
Theoretical pI: | 5.446 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 47.678 | ||
aromaticity | 0.056 | ||
GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.250 | ||
sheet | 0.250 |