| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332280.1 | complete | 108 | 182-508(+) |
Amino Acid sequence : | |||
| MLLICGQRQRRWLSLGFGLEDLDSLPGEVRIIAAKVAVSSSFLVPEVSSPLQVQVDGDHSWPEVEVLLDKCQNILVRDLTSLVSINEHRKWLCYTNSIQHLHNGGGLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,061.689 | ||
| Theoretical pI: | 5.446 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 47.678 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.250 | ||
| sheet | 0.250 | ||