Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332283.1 | complete | 194 | 263-847(+) |
Amino Acid sequence : | |||
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGSHRISRG* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 16,868.594 | ||
Theoretical pI: | 10.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 58.742 | ||
aromaticity | 0.062 | ||
GRAVY | -1.241 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.240 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332283.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
LYRSNSFVQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLRRLQYSKGIDASSCSSPSRRDADLRQNPNRKDDYPRGREFRHNRQREGEDPRQ GRYSTGSAAADLRREAARRRQNPSRL* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,868.594 | ||
Theoretical pI: | 10.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 58.742 | ||
aromaticity | 0.062 | ||
GRAVY | -1.241 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.240 | ||
sheet | 0.192 |