| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332283.1 | complete | 194 | 263-847(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGSHRISRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 16,868.594 | ||
| Theoretical pI: | 10.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 58.742 | ||
| aromaticity | 0.062 | ||
| GRAVY | -1.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.240 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332283.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
| LYRSNSFVQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLRRLQYSKGIDASSCSSPSRRDADLRQNPNRKDDYPRGREFRHNRQREGEDPRQ GRYSTGSAAADLRREAARRRQNPSRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,868.594 | ||
| Theoretical pI: | 10.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 58.742 | ||
| aromaticity | 0.062 | ||
| GRAVY | -1.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.240 | ||
| sheet | 0.192 | ||