| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332290.1 | 5prime_partial | 190 | 801-229(-) |
Amino Acid sequence : | |||
| SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHTNGLTLISR AHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPDYFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,722.190 | ||
| Theoretical pI: | 4.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
| Instability index: | 38.318 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.232 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332290.1 | 5prime_partial | 190 | 801-229(-) |
Amino Acid sequence : | |||
| SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHTNGLTLISR AHQLVMEGYNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQIEPDTTRKTPDYFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,722.190 | ||
| Theoretical pI: | 4.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
| Instability index: | 38.318 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.232 | ||
| sheet | 0.221 | ||