| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332306.1 | 5prime_partial | 237 | 1-714(+) |
Amino Acid sequence : | |||
| DLLKKNNHVISVIGDGAMTAGQAYEALNNAGYLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALSKALTKLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEE LGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGIGLNIFQKRFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 15,706.742 | ||
| Theoretical pI: | 5.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 51.194 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.214 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332306.1 | 5prime_partial | 140 | 768-346(-) |
Amino Acid sequence : | |||
| ACSEGDSVLLGDPHVEATSGEALLEDVETDSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLHLFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRRHLLNFLENINK IFHTMPINRSDVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,706.742 | ||
| Theoretical pI: | 5.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 51.194 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.214 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332306.1 | 5prime_partial | 237 | 1-714(+) |
Amino Acid sequence : | |||
| DLLKKNNHVISVIGDGAMTAGQAYEALNNAGYLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALSKALTKLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEE LGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGIGLNIFQKRFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 15,706.742 | ||
| Theoretical pI: | 5.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 51.194 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.214 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332306.1 | 5prime_partial | 140 | 768-346(-) |
Amino Acid sequence : | |||
| ACSEGDSVLLGDPHVEATSGEALLEDVETDSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLHLFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRRHLLNFLENINK IFHTMPINRSDVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,706.742 | ||
| Theoretical pI: | 5.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 51.194 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.214 | ||
| sheet | 0.264 | ||