Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332310.1 | complete | 172 | 1-519(+) |
Amino Acid sequence : | |||
MALFSATFTTSSSFQSLPLNRTGVKPENKWRLSYAMKSEDSSNSRNSGGSHRRIWRRRKLVQKDYILHYRMERVPFLEEQVRKIRETGELLTMDIERLLLSEDNRFDFVNEVAAEAKQYV ENNRDEYGAKKAILHVISNRMNDSGVYRPEAYKEDDPYKPGPGYLRQELYDK* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 20,277.577 | ||
Theoretical pI: | 9.195 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
Instability index: | 54.969 | ||
aromaticity | 0.105 | ||
GRAVY | -0.942 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.233 | ||
sheet | 0.262 |