| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332312.1 | complete | 174 | 106-630(+) |
Amino Acid sequence : | |||
| MQSQVVCSGCRSLLMYPSGATNVCCALCNSVTAIPPQGMEMAQLICGGCRTLLMHTRGATSVRCSCCHTVNLAPVNTAHINCGNCHTTLMYPYGAPSVKCAVCQYITNVNMGNVRVPLPM HRPIGPASPTPTPSAAAPLPNSQSQTVVVENPMSVDKSGKLVSNVVVGITTDKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 16,594.091 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 45.486 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.255 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332312.1 | complete | 153 | 468-7(-) |
Amino Acid sequence : | |||
| MHRKRDTNISHIDICYVLTNSAFDRWSTVRIHERRVTVSAVDVSGIYWSEVYRVTAGASHTGSTTSVHQECTAASTYQLGHFHSLRGNGGDGITQGAAHIGGAAGVHEKTPAPAAHYLAL HSSSHTTNGNATKNRSHRRNAADGFAIHRRLVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,594.091 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 45.486 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.255 | ||
| sheet | 0.190 | ||