| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332317.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEK | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,154.450 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.762 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.212 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332317.1 | 5prime_partial | 113 | 762-421(-) |
Amino Acid sequence : | |||
| LLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,154.450 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.762 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.212 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332317.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEK | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,154.450 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.762 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.212 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332317.1 | 5prime_partial | 113 | 762-421(-) |
Amino Acid sequence : | |||
| LLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,154.450 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.762 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.212 | ||
| sheet | 0.239 | ||