Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332317.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEK | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 13,154.450 | ||
Theoretical pI: | 11.727 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.762 | ||
aromaticity | 0.035 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.212 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332317.1 | 5prime_partial | 113 | 762-421(-) |
Amino Acid sequence : | |||
LLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,154.450 | ||
Theoretical pI: | 11.727 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.762 | ||
aromaticity | 0.035 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.212 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332317.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADA LPYLGWLDLGGHEK | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 13,154.450 | ||
Theoretical pI: | 11.727 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.762 | ||
aromaticity | 0.035 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.212 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332317.1 | 5prime_partial | 113 | 762-421(-) |
Amino Acid sequence : | |||
LLMPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,154.450 | ||
Theoretical pI: | 11.727 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.762 | ||
aromaticity | 0.035 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.212 | ||
sheet | 0.239 |