Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332319.1 | 5prime_partial | 228 | 894-208(-) |
Amino Acid sequence : | |||
PQFPFKVLMEEWVGVSACVLGDMASRPNFGLNELDFVFSTLVVGSIMNFVLMYLLAPTMSSATLTLPGIFANSPTSHMFEPGAYSLLSRVGTFVYKGTLFAAVGFAAGLAGTALSNGLIK MRKKMDPSFETPNKAPPTVLNAVTWAIHMGVSSNFRYQTLNGIEYVLAKGFSPALFKTSVVVLRCLNNILGGMSFVVLARLTGSQSVEGEKEKVVSEAESDDLLPVHK* | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 15,925.562 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 43.175 | ||
aromaticity | 0.082 | ||
GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.279 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332319.1 | complete | 147 | 449-892(+) |
Amino Acid sequence : | |||
MWIAQVTAFKTVGGALFGVSKLGSIFFLILISPLESAVPASPAAKPTAANRVPLYTKVPTLLNKLYAPGSNMWLVGEFAKMPGRVRVADDMVGAKRYMSTKFMMEPTTSVENTKSSSFRP KLGRDAMSPRTQALTPTHSSMRTLKGN* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 15,925.562 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 43.175 | ||
aromaticity | 0.082 | ||
GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.279 | ||
sheet | 0.279 |