| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332319.1 | 5prime_partial | 228 | 894-208(-) |
Amino Acid sequence : | |||
| PQFPFKVLMEEWVGVSACVLGDMASRPNFGLNELDFVFSTLVVGSIMNFVLMYLLAPTMSSATLTLPGIFANSPTSHMFEPGAYSLLSRVGTFVYKGTLFAAVGFAAGLAGTALSNGLIK MRKKMDPSFETPNKAPPTVLNAVTWAIHMGVSSNFRYQTLNGIEYVLAKGFSPALFKTSVVVLRCLNNILGGMSFVVLARLTGSQSVEGEKEKVVSEAESDDLLPVHK* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 15,925.562 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 43.175 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.279 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332319.1 | complete | 147 | 449-892(+) |
Amino Acid sequence : | |||
| MWIAQVTAFKTVGGALFGVSKLGSIFFLILISPLESAVPASPAAKPTAANRVPLYTKVPTLLNKLYAPGSNMWLVGEFAKMPGRVRVADDMVGAKRYMSTKFMMEPTTSVENTKSSSFRP KLGRDAMSPRTQALTPTHSSMRTLKGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,925.562 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 43.175 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.279 | ||
| sheet | 0.279 | ||