| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332322.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| RVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQ MKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNXEEATLGGYTILKESKVVVNAWWLSNNP EWW | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,020.674 | ||
| Theoretical pI: | 5.226 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 64.389 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.224 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332322.1 | 3prime_partial | 107 | 322-2(-) |
Amino Acid sequence : | |||
| MLFSVFSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHPVHDVIEHELQPPPNNQPFLSDP | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,020.674 | ||
| Theoretical pI: | 5.226 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 64.389 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.224 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332322.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| RVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQ MKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNXEEATLGGYTILKESKVVVNAWWLSNNP EWW | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,020.674 | ||
| Theoretical pI: | 5.226 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 64.389 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.224 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332322.1 | 3prime_partial | 107 | 322-2(-) |
Amino Acid sequence : | |||
| MLFSVFSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHPVHDVIEHELQPPPNNQPFLSDP | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,020.674 | ||
| Theoretical pI: | 5.226 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 64.389 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.224 | ||
| sheet | 0.290 | ||