| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332330.1 | internal | 254 | 762-1(-) |
Amino Acid sequence : | |||
| TVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRM TPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVI GQYCDQSVPDGLAA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,586.843 | ||
| Theoretical pI: | 8.362 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 43.589 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332330.1 | internal | 254 | 762-1(-) |
Amino Acid sequence : | |||
| TVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRM TPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVI GQYCDQSVPDGLAA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,586.843 | ||
| Theoretical pI: | 8.362 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 43.589 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.181 | ||