Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332332.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
VNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLLHGGSALIIDDPNDA VEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,239.777 | ||
Theoretical pI: | 5.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 44.757 | ||
aromaticity | 0.082 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.220 | ||
sheet | 0.280 |