Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332340.1 | 5prime_partial | 160 | 1-483(+) |
Amino Acid sequence : | |||
QTPPVAHRDLKAENLLLGPDGQWKLCDFGSTSTNHKRFEKPEEMGIEEDNIRKHTTPAYRAPEMWDLFRRELINEKVDIWALGCLLFRICYLKLAFDGESKLQILNGNYRIPDQPKYNTL LTDLIKDMLQPSPDDRPDITQASILLDWPFMPMNLGVVSC* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,502.072 | ||
Theoretical pI: | 5.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 42.136 | ||
aromaticity | 0.088 | ||
GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.219 | ||
sheet | 0.269 |