| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332348.1 | internal | 226 | 678-1(-) |
Amino Acid sequence : | |||
| IQPQETKPSALWLLPLEWLHNFPCEVGIISPEMPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVDKHRQRLRHTDGVRHLHDAPPGEPVGDDALGRLPHDVG ATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVV | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 23,778.823 | ||
| Theoretical pI: | 8.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 11.853 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.258 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332348.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
| DNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVAN GLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,778.823 | ||
| Theoretical pI: | 8.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 11.853 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.258 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332348.1 | internal | 226 | 678-1(-) |
Amino Acid sequence : | |||
| IQPQETKPSALWLLPLEWLHNFPCEVGIISPEMPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVDKHRQRLRHTDGVRHLHDAPPGEPVGDDALGRLPHDVG ATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVV | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 23,778.823 | ||
| Theoretical pI: | 8.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 11.853 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.258 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332348.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
| DNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVAN GLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,778.823 | ||
| Theoretical pI: | 8.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 11.853 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.309 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.258 | ||
| sheet | 0.175 | ||