| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332350.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| VKFLKPNKAVVILQGRYAGRKAVIIRSFDDGTRDRPYGHCLVAGLSKYPRKVIRKDSAKKQAKKSRVKCFIKLVNYNHIMPTRYTLDVDLKDVVTPDCLQSKDKKVTAAKEPKARFEERF KTGKNRWFFTKLRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,621.266 | ||
| Theoretical pI: | 10.363 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 37.701 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.157 | ||
| sheet | 0.164 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332350.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| VKFLKPNKAVVILQGRYAGRKAVIIRSFDDGTRDRPYGHCLVAGLSKYPRKVIRKDSAKKQAKKSRVKCFIKLVNYNHIMPTRYTLDVDLKDVVTPDCLQSKDKKVTAAKEPKARFEERF KTGKNRWFFTKLRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,621.266 | ||
| Theoretical pI: | 10.363 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 37.701 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.157 | ||
| sheet | 0.164 | ||