Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	5prime_partial	209	1-630(+)
Amino Acid sequence :
ILRRLEGKVALITGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAGVFLG TKHAARVMIPKRRGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMSRKFLESSDEGLTDFFYT*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	5prime_partial	132	636-238(-)
Amino Acid sequence :
LLSGIKEIRQPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVGADAAQHAGDGRRRDDAPPPLGDHHPGGVFRPQKHAGEVHADDAVEFRQREVGEQLELR RLDDAGVVVHDV*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	complete	109	557-228(-)
Amino Acid sequence :
MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	5prime_partial	209	1-630(+)
Amino Acid sequence :
ILRRLEGKVALITGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAGVFLG TKHAARVMIPKRRGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMSRKFLESSDEGLTDFFYT*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	5prime_partial	132	636-238(-)
Amino Acid sequence :
LLSGIKEIRQPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVGADAAQHAGDGRRRDDAPPPLGDHHPGGVFRPQKHAGEVHADDAVEFRQREVGEQLELR RLDDAGVVVHDV*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332357.1	complete	109	557-228(-)
Amino Acid sequence :
MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275