| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 5prime_partial | 207 | 2-625(+) |
Amino Acid sequence : | |||
| KHHPGQIESAAIMEHILNGSSYIKEAQKIHETDPLQKPKQDRYALRTSPQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFS ELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTF* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| KTPSRPDRIGRHNGTHPQRKLVHQRSTKDTRDGSPAEAQAGPVRPPYVPPMARPPGRGHPDLDQIHREGDQLCQRQPTNRRFSKQGPPRRQLPGDPDRGLHGQHAFSHRIDRQAHVRAIL RAGERLLQQRPPLESLGGARPELGLWFQGRGNRDGRLLLRAPILGQSGDEPRAERRATQPRCELIRPHFLKKNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
| MSLPIDAMAKRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSVSCIFCASLMYELPLRMCSIMAADSIWPGWCF | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 5prime_partial | 207 | 2-625(+) |
Amino Acid sequence : | |||
| KHHPGQIESAAIMEHILNGSSYIKEAQKIHETDPLQKPKQDRYALRTSPQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFS ELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTF* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| KTPSRPDRIGRHNGTHPQRKLVHQRSTKDTRDGSPAEAQAGPVRPPYVPPMARPPGRGHPDLDQIHREGDQLCQRQPTNRRFSKQGPPRRQLPGDPDRGLHGQHAFSHRIDRQAHVRAIL RAGERLLQQRPPLESLGGARPELGLWFQGRGNRDGRLLLRAPILGQSGDEPRAERRATQPRCELIRPHFLKKNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332361.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
| MSLPIDAMAKRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSVSCIFCASLMYELPLRMCSIMAADSIWPGWCF | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,937.235 | ||
| Theoretical pI: | 8.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 46.083 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.261 | ||
| sheet | 0.287 | ||