Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 5prime_partial | 207 | 2-625(+) |
Amino Acid sequence : | |||
KHHPGQIESAAIMEHILNGSSYIKEAQKIHETDPLQKPKQDRYALRTSPQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFS ELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTF* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
KTPSRPDRIGRHNGTHPQRKLVHQRSTKDTRDGSPAEAQAGPVRPPYVPPMARPPGRGHPDLDQIHREGDQLCQRQPTNRRFSKQGPPRRQLPGDPDRGLHGQHAFSHRIDRQAHVRAIL RAGERLLQQRPPLESLGGARPELGLWFQGRGNRDGRLLLRAPILGQSGDEPRAERRATQPRCELIRPHFLKKNS* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
MSLPIDAMAKRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSVSCIFCASLMYELPLRMCSIMAADSIWPGWCF | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 5prime_partial | 207 | 2-625(+) |
Amino Acid sequence : | |||
KHHPGQIESAAIMEHILNGSSYIKEAQKIHETDPLQKPKQDRYALRTSPQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFS ELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTF* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
KTPSRPDRIGRHNGTHPQRKLVHQRSTKDTRDGSPAEAQAGPVRPPYVPPMARPPGRGHPDLDQIHREGDQLCQRQPTNRRFSKQGPPRRQLPGDPDRGLHGQHAFSHRIDRQAHVRAIL RAGERLLQQRPPLESLGGARPELGLWFQGRGNRDGRLLLRAPILGQSGDEPRAERRATQPRCELIRPHFLKKNS* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332361.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
MSLPIDAMAKRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSVSCIFCASLMYELPLRMCSIMAADSIWPGWCF | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,937.235 | ||
Theoretical pI: | 8.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 46.083 | ||
aromaticity | 0.096 | ||
GRAVY | 0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.261 | ||
sheet | 0.287 |