| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332363.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| HQPPSNTNTVIMPESLPSFSSSVKLKYVKQGYQYLVNHILTFTLIPIIVAVAVQLLRLGPNEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFSTF MEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMESARGEAEVVIFSSIDSLMQKTGIRAKDIDILIVNCSLFSPTSSLSAMIV | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 15,416.998 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 90.565 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.250 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332363.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| PPTTLKYKHRHHAGIPPQFLQLRQAQVCKTRLPIPCQPHPHLHSHPHHRRRRRPAPPIRPQRNARHLELSPIGRSPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVPRPLLHL HGAFPPHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,416.998 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 90.565 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.250 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332363.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| HQPPSNTNTVIMPESLPSFSSSVKLKYVKQGYQYLVNHILTFTLIPIIVAVAVQLLRLGPNEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFSTF MEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMESARGEAEVVIFSSIDSLMQKTGIRAKDIDILIVNCSLFSPTSSLSAMIV | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 15,416.998 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 90.565 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.250 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332363.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| PPTTLKYKHRHHAGIPPQFLQLRQAQVCKTRLPIPCQPHPHLHSHPHHRRRRRPAPPIRPQRNARHLELSPIGRSPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVPRPLLHL HGAFPPHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,416.998 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 90.565 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.250 | ||
| sheet | 0.235 | ||