| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332366.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
| DTTAGYDLATVVAFLALFVFTLSVYFMSRPRNIYLVDFACYKPTDDFKVTKDEFIDLARKSGKFDEASLEFQRRILESSGLGDETYVPKSIGSPENTATMKEGRAEASTVIFGALDELFE KTRIRPKDVGVLVVNCSLFNPTPSLSAMIINHYKMRGNILSFNLGGMGCSAAIIALDLARDMLQANPNNYAVVVSTEMVGFNWYPGKERSMLIPNCYFRMGC | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 16,185.284 | ||
| Theoretical pI: | 10.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 70.570 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.170 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332366.1 | 5prime_partial | 141 | 667-242(-) |
Amino Acid sequence : | |||
| AAHPEVAIWYKHRSLLPRVPIEPHHLRAHHHRVVVRVRLQHVARQIQRDYGGAAPHPPQIEAQDVPPHLVVVDYHRRQRRRRVEQAAIHHQHAHVLGADPCLLEQLVQRPEDDGGGLRPP FLHRGGVLRRADRFGDVGFVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,185.284 | ||
| Theoretical pI: | 10.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 70.570 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.170 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332366.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
| DTTAGYDLATVVAFLALFVFTLSVYFMSRPRNIYLVDFACYKPTDDFKVTKDEFIDLARKSGKFDEASLEFQRRILESSGLGDETYVPKSIGSPENTATMKEGRAEASTVIFGALDELFE KTRIRPKDVGVLVVNCSLFNPTPSLSAMIINHYKMRGNILSFNLGGMGCSAAIIALDLARDMLQANPNNYAVVVSTEMVGFNWYPGKERSMLIPNCYFRMGC | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 16,185.284 | ||
| Theoretical pI: | 10.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 70.570 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.170 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332366.1 | 5prime_partial | 141 | 667-242(-) |
Amino Acid sequence : | |||
| AAHPEVAIWYKHRSLLPRVPIEPHHLRAHHHRVVVRVRLQHVARQIQRDYGGAAPHPPQIEAQDVPPHLVVVDYHRRQRRRRVEQAAIHHQHAHVLGADPCLLEQLVQRPEDDGGGLRPP FLHRGGVLRRADRFGDVGFVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,185.284 | ||
| Theoretical pI: | 10.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 70.570 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.170 | ||
| sheet | 0.227 | ||