| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332369.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| EPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPG GSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQFFTVA | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,813.406 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 47.722 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.276 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332369.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| EPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPG GSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQFFTVA | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,813.406 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 47.722 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.276 | ||
| sheet | 0.236 | ||