| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| TTSTAAKSPPPPPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNV VFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYG DFIPILRPFLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | internal | 252 | 756-1(-) |
Amino Acid sequence : | |||
| ASQKRPQNRDEIAIVVLEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEH HVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRW WWWWRFRGGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| PPPPPRNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAML CSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| HLHRREISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| TTSTAAKSPPPPPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNV VFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYG DFIPILRPFLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | internal | 252 | 756-1(-) |
Amino Acid sequence : | |||
| ASQKRPQNRDEIAIVVLEALRQSTPLPIQRLQFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEH HVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEEKIHFRW WWWWRFRGGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| PPPPPRNLHHHHHRKWIFSSSRRRFSASSSPSSSPPWSRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAML CSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332396.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| HLHRREISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,389.608 | ||
| Theoretical pI: | 11.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 114.599 | ||
| aromaticity | 0.027 | ||
| GRAVY | -1.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.127 | ||
| turn | 0.291 | ||
| sheet | 0.255 | ||