| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332406.1 | internal | 271 | 2-814(+) |
Amino Acid sequence : | |||
| DSRILYRSNSFVQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL RGGMQIFVKTLTGQTITLEVESSDTIDNVKA | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 30,444.509 | ||
| Theoretical pI: | 7.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 29.753 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.173 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332406.1 | internal | 271 | 2-814(+) |
Amino Acid sequence : | |||
| DSRILYRSNSFVQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL RGGMQIFVKTLTGQTITLEVESSDTIDNVKA | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 30,444.509 | ||
| Theoretical pI: | 7.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 29.753 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.173 | ||
| sheet | 0.225 | ||