Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332417.1 | complete | 181 | 625-80(-) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,457.542 | ||
Theoretical pI: | 5.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.305 | ||
aromaticity | 0.070 | ||
GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.191 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332417.1 | 5prime_partial | 157 | 1-474(+) |
Amino Acid sequence : | |||
SDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDT AEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,457.542 | ||
Theoretical pI: | 5.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.305 | ||
aromaticity | 0.070 | ||
GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.191 | ||
sheet | 0.242 |