| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332417.1 | complete | 181 | 625-80(-) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,457.542 | ||
| Theoretical pI: | 5.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 43.305 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.191 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332417.1 | 5prime_partial | 157 | 1-474(+) |
Amino Acid sequence : | |||
| SDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDT AEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,457.542 | ||
| Theoretical pI: | 5.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 43.305 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.191 | ||
| sheet | 0.242 | ||