| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332418.1 | complete | 181 | 38-583(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,572.629 | ||
| Theoretical pI: | 5.700 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 44.313 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.190 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332418.1 | 5prime_partial | 158 | 665-189(-) |
Amino Acid sequence : | |||
| DSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRD TAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,572.629 | ||
| Theoretical pI: | 5.700 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 44.313 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.190 | ||
| sheet | 0.241 | ||