Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332440.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
KVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPD LIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMR ATDVMNAGKVGVVCGYGN | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 26,943.140 | ||
Theoretical pI: | 5.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.826 | ||
aromaticity | 0.012 | ||
GRAVY | -0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.287 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332440.1 | internal | 258 | 774-1(-) |
Amino Acid sequence : | |||
ISITTHNSHLSGIHHISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLR LHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHL GELDFEAAEVGLGHVLDL | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 26,943.140 | ||
Theoretical pI: | 5.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.826 | ||
aromaticity | 0.012 | ||
GRAVY | -0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.287 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332440.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
KVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPD LIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMR ATDVMNAGKVGVVCGYGN | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 26,943.140 | ||
Theoretical pI: | 5.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.826 | ||
aromaticity | 0.012 | ||
GRAVY | -0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.287 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332440.1 | internal | 258 | 774-1(-) |
Amino Acid sequence : | |||
ISITTHNSHLSGIHHISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLR LHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHL GELDFEAAEVGLGHVLDL | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 26,943.140 | ||
Theoretical pI: | 5.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.826 | ||
aromaticity | 0.012 | ||
GRAVY | -0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.287 | ||
sheet | 0.295 |