Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332443.1 | 5prime_partial | 207 | 794-171(-) |
Amino Acid sequence : | |||
KIREERRKERERERRLEAKDAARGKKSKITRDRDRDISEKVALGMANTGAKGGEVMYDQRLFNQEKGMDSGFATDDAYNIYDKGLFTTQSALTTLYRPKKDDDDEMYVGADEQLEKIKKT ERFKVDRQFTGTSERSGPRDGPLEFDKEQVEEDPFGLNQFLTEVKTGKKAMDKIGSGGTMKASAGSMRDGSDGSGRSRINFERKGGR* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 18,609.375 | ||
Theoretical pI: | 9.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 57.635 | ||
aromaticity | 0.095 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.331 | ||
sheet | 0.201 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332443.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
VTEQEIHAVAQHFARKFYVGNVDMQAQIGVRHCPHFHLCILQLLQLKYNNTTSSKPIQRPPFLSKLIRDLPDPSEPSRIDPALAFMVPPLPILSMAFLPVFTSVKNWFRPNGSSSTCSLS NSKGPSLGPLLSDVPVNCLSTLKRSVFFIFSSCSSAPTYISSSSSFLGL* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,609.375 | ||
Theoretical pI: | 9.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 57.635 | ||
aromaticity | 0.095 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.331 | ||
sheet | 0.201 |