| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332454.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| VGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFLGARLSLDMTMMAMTTLGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,183.213 | ||
| Theoretical pI: | 4.893 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 26.705 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.171 | ||
| sheet | 0.325 | ||