Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332454.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
VGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFLGARLSLDMTMMAMTTLGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,183.213 | ||
Theoretical pI: | 4.893 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 26.705 | ||
aromaticity | 0.077 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.171 | ||
sheet | 0.325 |