Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	3prime_partial	284	3-854(+)
Amino Acid sequence :
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGA
Physicochemical properties
Number of amino acids:		284
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	3prime_partial	143	431-3(-)
Amino Acid sequence :
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH
Physicochemical properties
Number of amino acids:		143
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	5prime_partial	135	854-447(-)
Amino Acid sequence :
GATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQ PGARTVLADLRQTSA*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	3prime_partial	284	3-854(+)
Amino Acid sequence :
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGA
Physicochemical properties
Number of amino acids:		284
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	3prime_partial	143	431-3(-)
Amino Acid sequence :
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH
Physicochemical properties
Number of amino acids:		143
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332475.1	5prime_partial	135	854-447(-)
Amino Acid sequence :
GATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQ PGARTVLADLRQTSA*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,696.072
Theoretical pI:		4.050
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		24.100
aromaticity		0.007
GRAVY		0.014
Secondary Structure Fraction
Helix		0.311
turn		0.267
sheet		0.237