| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332479.1 | 3prime_partial | 245 | 85-819(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFDEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPGTDKNPYLGFIYTSFQERATFVSHGNTARLGKE HGDVK | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,738.300 | ||
| Theoretical pI: | 6.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
| Instability index: | 43.564 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.237 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332479.1 | 3prime_partial | 245 | 85-819(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFDEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPGTDKNPYLGFIYTSFQERATFVSHGNTARLGKE HGDVK | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,738.300 | ||
| Theoretical pI: | 6.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
| Instability index: | 43.564 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.237 | ||
| sheet | 0.253 | ||