Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332486.1 | 5prime_partial | 212 | 2-640(+) |
Amino Acid sequence : | |||
LDTSVYPREEECLKELRALTWTHPRAVMGTAPETGQFMALLLKTINAKKTLEIGVFTGYSLLLTALAIPHDGKITAIDINRDTYEIGLPIIEKAGVKHKIDFIESKALPALDHLLKDGEN KESFDFVFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFIAADSRVQISQLPVGDGITVCRRK* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 13,536.717 | ||
Theoretical pI: | 9.759 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 30.992 | ||
aromaticity | 0.087 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.200 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332486.1 | complete | 115 | 688-341(-) |
Amino Acid sequence : | |||
MLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKHEVKTLFILPIFE* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,536.717 | ||
Theoretical pI: | 9.759 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 30.992 | ||
aromaticity | 0.087 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.200 | ||
sheet | 0.209 |