Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332493.1	complete	150	56-508(+)
Amino Acid sequence :
MALSSDRQSLIPSFLYTSSFTSKSLNLHKNVAPSSSPAAASSPNGGFMIQAPSEPGKIEMYSPQFYAACTVGGILSCGLTHMAVTPLDLVKCNMQIDPAKYKSISSGFGVLLKEQGARGF FRGWVPTLLGYFFFCRLQIWILRVFQEVLF*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,939.329
Theoretical pI:		10.125
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		36.108
aromaticity		0.067
GRAVY		-0.488
Secondary Structure Fraction
Helix		0.282
turn		0.282
sheet		0.228

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332493.1	5prime_partial	149	881-432(-)
Amino Acid sequence :
TSDISTSKTHTKLERLAAFIFRRGDSMLVKELHNSLEGCKLHHCIWNLTPPEWNKPLVQSKSSFRFHKLGKSITQTSSETRLSLNSNLHSFKRAKSNVRNHLSRCRPSKINESLVFSSIF CSSEVRIVLLEKLVESKFAGGKKKSNLAE*
Physicochemical properties
Number of amino acids:		149
Molecular weight:		16,939.329
Theoretical pI:		10.125
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		36.108
aromaticity		0.067
GRAVY		-0.488
Secondary Structure Fraction
Helix		0.282
turn		0.282
sheet		0.228