| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | 5prime_partial | 244 | 2-736(+) |
Amino Acid sequence : | |||
| SWTLVLHFSQSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFT DKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATXKTVDGPSAQDWRGGRAASFNIIPSSTGAAKAVGKVLPA LNGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | complete | 119 | 561-202(-) |
Amino Acid sequence : | |||
| MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | complete | 114 | 385-41(-) |
Amino Acid sequence : | |||
| MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSNKLNIVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | 5prime_partial | 244 | 2-736(+) |
Amino Acid sequence : | |||
| SWTLVLHFSQSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFT DKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATXKTVDGPSAQDWRGGRAASFNIIPSSTGAAKAVGKVLPA LNGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | complete | 119 | 561-202(-) |
Amino Acid sequence : | |||
| MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332502.1 | complete | 114 | 385-41(-) |
Amino Acid sequence : | |||
| MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSNKLNIVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,761.347 | ||
| Theoretical pI: | 5.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 37.633 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.333 | ||
| sheet | 0.246 | ||