Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332503.1	complete	143	3-434(+)
Amino Acid sequence :
MGPLLLLKLYGIPYLGFVMWLDLVTYLHHHGHDDKLPWYKGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLFPQIPHYHLIEATEAAKPVLGKYYREPKKSGPLPFYLLGLLVQS MKRDHFVSDTGDIVYYQTDPDLN*
Physicochemical properties
Number of amino acids:		143
Molecular weight:		16,707.029
Theoretical pI:		6.618
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39880 39880
Instability index:		29.452
aromaticity		0.140
GRAVY		-0.295
Secondary Structure Fraction
Helix		0.399
turn		0.210
sheet		0.224