| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332520.1 | internal | 212 | 3-638(+) |
Amino Acid sequence : | |||
| LSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQG VHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHD | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,226.996 | ||
| Theoretical pI: | 5.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 40.016 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.212 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332520.1 | internal | 212 | 3-638(+) |
Amino Acid sequence : | |||
| LSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQG VHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHD | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,226.996 | ||
| Theoretical pI: | 5.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 40.016 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.212 | ||
| sheet | 0.226 | ||