| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332525.1 | internal | 294 | 1-882(+) |
Amino Acid sequence : | |||
| LPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFSEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYEGKVVIGMDVAASEFYGKDKTYDLNFKE ENNDGSAKISGDKLKDLYKSFVSEYPIVSIEDPFDQDDWDTYAKLTTEIGAKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMTSHRSGETEDTF IADLAVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGSEAVYAGVNFRAPVEP | |||
Physicochemical properties | |||
| Number of amino acids: | 294 | ||
| Molecular weight: | 32,020.927 | ||
| Theoretical pI: | 5.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 38.377 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.235 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332525.1 | internal | 294 | 1-882(+) |
Amino Acid sequence : | |||
| LPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFSEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYEGKVVIGMDVAASEFYGKDKTYDLNFKE ENNDGSAKISGDKLKDLYKSFVSEYPIVSIEDPFDQDDWDTYAKLTTEIGAKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMTSHRSGETEDTF IADLAVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGSEAVYAGVNFRAPVEP | |||
Physicochemical properties | |||
| Number of amino acids: | 294 | ||
| Molecular weight: | 32,020.927 | ||
| Theoretical pI: | 5.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 38.377 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.235 | ||
| sheet | 0.276 | ||