| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332532.1 | 5prime_partial | 193 | 652-71(-) |
Amino Acid sequence : | |||
| TTGVISGLRREISSAASGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGVSGVLVLDAPPNGPA GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCEVGDKVIVEVLRGDKLEKIPVVLEPKPDES* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 19,864.414 | ||
| Theoretical pI: | 5.195 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.275 | ||
| aromaticity | 0.031 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.326 | ||
| sheet | 0.187 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332532.1 | 5prime_partial | 193 | 652-71(-) |
Amino Acid sequence : | |||
| TTGVISGLRREISSAASGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGVSGVLVLDAPPNGPA GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCEVGDKVIVEVLRGDKLEKIPVVLEPKPDES* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 19,864.414 | ||
| Theoretical pI: | 5.195 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 24.275 | ||
| aromaticity | 0.031 | ||
| GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.326 | ||
| sheet | 0.187 | ||