| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332539.1 | 3prime_partial | 195 | 26-610(+) |
Amino Acid sequence : | |||
| MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALGRALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARELDITLPPFIDRTLLRARDPPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,414.199 | ||
| Theoretical pI: | 5.262 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 34.090 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.236 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332539.1 | 3prime_partial | 195 | 26-610(+) |
Amino Acid sequence : | |||
| MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALGRALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARELDITLPPFIDRTLLRARDPPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,414.199 | ||
| Theoretical pI: | 5.262 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 34.090 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.236 | ||
| sheet | 0.256 | ||