| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332547.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| TSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAIN | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 24,013.670 | ||
| Theoretical pI: | 4.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.814 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.293 | ||
| sheet | 0.332 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332547.1 | 5prime_partial | 232 | 715-17(-) |
Amino Acid sequence : | |||
| IDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALP GEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,013.670 | ||
| Theoretical pI: | 4.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.814 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.293 | ||
| sheet | 0.332 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332547.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| TSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAIN | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 24,013.670 | ||
| Theoretical pI: | 4.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.814 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.293 | ||
| sheet | 0.332 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332547.1 | 5prime_partial | 232 | 715-17(-) |
Amino Acid sequence : | |||
| IDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALP GEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,013.670 | ||
| Theoretical pI: | 4.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.814 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.293 | ||
| sheet | 0.332 | ||