Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332553.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
GTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKER TYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,454.392 | ||
Theoretical pI: | 11.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.610 | ||
aromaticity | 0.142 | ||
GRAVY | -0.751 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.228 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332553.1 | 3prime_partial | 127 | 383-3(-) |
Amino Acid sequence : | |||
MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRS | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 15,454.392 | ||
Theoretical pI: | 11.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.610 | ||
aromaticity | 0.142 | ||
GRAVY | -0.751 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.228 | ||
sheet | 0.134 |