Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332563.1 | complete | 140 | 196-618(+) |
Amino Acid sequence : | |||
MSKEKEKPPEPLDFFIWTVEDVGLWLEEINLGNYREIFKENGVNGEYLEGMSMFTTEQILRFIRKCHMKWGDFITLCKELRRIXVACLKGEQKVRRPWWAPACLSVVFVKAAKRNRQSRV VSLKLELDVDLAVYVCTINV* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 11,849.467 | ||
Theoretical pI: | 10.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 59.530 | ||
aromaticity | 0.107 | ||
GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.252 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332563.1 | complete | 104 | 608-294(-) |
Amino Acid sequence : | |||
MVHTYTAKSTSSSSFNDTTRDCLLRFAAFTNTTERQAGAHHGRRTFCSPFKQATXIRLSSLHKVIKSPHFMWHFRMNRRICSVVNIDIPSKYSPLTPFSLNISR* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,849.467 | ||
Theoretical pI: | 10.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 59.530 | ||
aromaticity | 0.107 | ||
GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.252 | ||
sheet | 0.155 |