Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332571.1 | 5prime_partial | 164 | 3-497(+) |
Amino Acid sequence : | |||
IDSALLRPGRIDMHIYFPLCDFNSFKNLANNYLGVKEHKLFPQVEEIFQSGATMSPAEISELMLVNRSSPSRALKSVISALQTHGRSGGKLATRLSDSAAASPAPPSVSEEAGGAAWKET MPKEFRKLYGLLRLKSCRKPGSFDHDESEIINGDGLSTQHSKHY* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,989.201 | ||
Theoretical pI: | 8.575 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 70.463 | ||
aromaticity | 0.073 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.299 | ||
sheet | 0.280 |