Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332582.1	complete	173	179-700(+)
Amino Acid sequence :
MPEANITHVGLKDFGIDGITLAVTVTVSNPYAVPIPIGKITYSVKSDGREVSSGSVGDAGVLKANDNTDLEVAVKVPYAATLNLLRDIVGDWDIDYLLESGLTVNLPVIGDFTIPLSYSG ELKLPTLTDIFPVKSSEGGMKLPSISDVFPVKSSEGGMKLPNISDVFNVKSTK*
Physicochemical properties
Number of amino acids:		173
Molecular weight:		18,282.704
Theoretical pI:		4.602
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 12950
Instability index:		32.410
aromaticity		0.064
GRAVY		0.149
Secondary Structure Fraction
Helix		0.353
turn		0.306
sheet		0.202