| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332582.1 | complete | 173 | 179-700(+) |
Amino Acid sequence : | |||
| MPEANITHVGLKDFGIDGITLAVTVTVSNPYAVPIPIGKITYSVKSDGREVSSGSVGDAGVLKANDNTDLEVAVKVPYAATLNLLRDIVGDWDIDYLLESGLTVNLPVIGDFTIPLSYSG ELKLPTLTDIFPVKSSEGGMKLPSISDVFPVKSSEGGMKLPNISDVFNVKSTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,282.704 | ||
| Theoretical pI: | 4.602 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 32.410 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.306 | ||
| sheet | 0.202 | ||